PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008768-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 335aa    MW: 36739.7 Da    PI: 7.4317
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008768-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1298142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
    NNU_008768-RA  98 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 142
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93991147IPR017930Myb domain
SuperFamilySSF466897.18E-1793148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1994146IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.9E-1195141IPR009057Homeodomain-like
SMARTSM007178.0E-1195145IPR001005SANT/Myb domain
PfamPF002491.1E-1098142IPR001005SANT/Myb domain
CDDcd001672.63E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKIFGVRL TDGSIRKSAS MGNLTHYTGS SNNNHQHNNT  60
LGSPGETPEH GASADGYASE DFVQGSSSSC RERKKGVPWT EEEHRMFLLG LQKLGKGDWR  120
GIARNYVISR TPTQVASHAQ KYFIRQSNVS RRKRRSSLFD IVTDESVDIP PVVSQELFPI  180
NHPQAETQSN NPLPVPPALD EECESMDSAT NSNDGEAVLP KPESTQSSYP VVFPAYFSPF  240
FPFSFPFWPG YNTEAMTKET YEIVKPTAIH SKSPINVDEL VGMSKLSLGE SLANSGPSSL  300
SLQLVEGSTR QSAFHASSAT GHSSMDRNSN PIHAV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258818.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B01e-39MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A067FDS70.0A0A067FDS7_CITSI; Uncharacterized protein
STRINGPOPTR_0001s15510.11e-175(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-116MYB_related family protein